727 internal and functional behavior of a master slave j k flip flop
Báo cáo khoa học: Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis docx
... (Forward) TAAGCTACTACGTAAAGAATATATC (Reverse) GATAAGGTACCTGCACTGACACGGATGAAAGC (Forward) CATATATTCTTTACGTAGTAGCTTA (Reverse) FEBS Journal 272 (2005) 4091–4102 ª 2005 FEBS 4099 Molecular characterization ... Molecular characterization of ANKHD1 splice variant studies blast searches of VBARP revealed that this protein has homology to human ankyrin repeat and KH domain containing 1(ANKHD1) variants, and ... National Laboratory for Oncogenes and Related Genes Shanghai Cancer Institute, Shanghai, China Smith RK, Carroll PM, Allard JD & Simon MA (2000) MASK, a large ankyrin repeat and KH domain-containing...
- 12
- 561
- 0
Báo cáo khoa học: Identification and functional expression of a second human b-galactoside a2,6-sialyltransferase, ST6Gal II docx
... a Galb1–3 (4) GlcNAc a2 ,3-sialyltransferase and a Galb1–4GlcNAc a2 ,6-sialyltransferase from rat liver J Biol Chem 257, 13845–13853 38 Nagase, T., Nakayama, M., Nakajima, D., Kikuno, R & Ohara, ... two specific primers For 6I 5¢-CGATGAATTC GTTAACGCTCATCACCATCACCATCACGGGAAA TTGGCCATGGGGT-3¢ containing a HpaI site and Back 6I 5¢-CGATGGTACCGTACTTGTTCATGCTTAGG-3¢ and subcloned into pUC19 for further ... Application to cloning of putative mouse, b-galactoside a2 ,6-sialyltransferase cDNA Bioorg Med Chem 1, 141–145 24 Kurosawa, N., Kawasaki, M., Hamamoto, T., Nakaoka, T., Lee, Y.C., Arita, M & Tsuji,...
- 12
- 584
- 0
Báo cáo khoa học: Identification and functional characterization of a novel barnacle cement protein pptx
... VPPPCDFSIKSKQKQVGVTAGGASVSAKGATSGSGSITCITKTPTSVTKKVAAGNAGVSG Mrcp1 9k Bacp1 9k Bicp1 9k 70 80 90 100 110 120 TSVSAGDGAFGNLAAALTLVEDTEDGLGVKTKNGGKGFSEGTAAISQTAGANGGATVKKA VSASAANGFFKNLGKATTEVKTTKDGTKVKTKTAGKGKTGGTATTIQIADANGGVSEKSL ... VSASAANGFFKNLGKATTEVKTTKDGTKVKTKTAGKGKTGGTATTIQIADANGGVSEKSL AAAAAGNGVFKNLVTALTNISTTDDITKVQTQTIGSGGTGGAATILQLADANGGAALKEV Mrcp1 9k Bacp1 9k Bicp1 9k 130 140 150 160 170 KLDLLTDGEDLFDTKKVEKGTVTSSSSHQGSGAGDSIFEILNEAESKIKKSGD KLDLLTDGLKFVKVTEKKQGTATSSSGHKASGVGHSVFKVLNEAETELELKGL ... biaevaluation Mrcp1 9k Bacp1 9k Bicp1 9k 10 20 30 40 50 60 VPPPCDLGIASKVKQKGVTGGGASVSTTSATQGSGTTNCVTRTPNSVEKKNVAGNTGVTA VPPPCDLSIKSKLKQVGATAGNAAVTTTGTTSGSGVVKCVVRTPTSVEKKAAVGNTGLSA VPPPCDFSIKSKQKQVGVTAGGASVSAKGATSGSGSITCITKTPTSVTKKVAAGNAGVSG...
- 11
- 488
- 0
Báo cáo Y học: Structural and functional characterization of a C-type lectin-like antifreeze protein from rainbow smelt (Osmerus mordax) potx
... band corresponded to the gradual increase in intensity of a higher-molecular-mass band The apparent molecular mass of this band was 38 kDa, which is substantially higher than the molecular mass ... faster than its actual mass would predict because of limited linearization in SDS The value of 38 kDa is consistent with such a dimer band A small amount of a high-molecular-mass aggregate was evident ... function as an AFP as well as its relationship to other CTLDs MATERIALS AND METHODS Materials N-Glycosidase F and endoproteinase Glu-C were obtained from Roche Molecular Biochemicals (Laval, Canada)...
- 8
- 518
- 0
Báo cáo khoa học: Molecular cloning and functional expression of a gene encoding an antiarrhythmia peptide derived from the scorpion toxin pptx
... characterized by minima at 207 nm and by a maximum at 190 nm The negative band at 207 nm had a lower intensity in the case of rBmKIM in comparison with that in the spectra of AaHIT2 (a- toxin) and ... they are equally potent for cardiac and neuronal Na+ channels [39] Pharmacological activity of recombinant BmKIM Injected into larvae, rBmKIM caused a slow, progressive depressant flaccid paralysis ... mgÆkg)1 These data indicated that rBmKIM had toxicity to both mammals and insects, though the toxicity was at a lower level Assay of antiarrhythmia activity Table illustrates the effects of rBmKIM...
- 8
- 473
- 0
Báo cáo y học: "Structural and functional map of a bacterial nucleoid" doc
... S, Jiménez-Jacinto V, Peralta-Gil M, SantosZavaleta A, Peñaloza-Spinola MI, Contreras-Moreira B, Segura-Salazar J, Muñiz-Rascado L, Martínez-Flores I, Salgado H, Bonavides-Martínez C, Abreu-Goodger ... growing phases - that is, lag, early, mid, and late exponential and early and late stationary phases With these data, investigators should be able to obtain a dynamic picture of protein occupancy ... 3:157-169 Ali Azam T, Iwata A, Nishimura A, Ueda S, Ishihama A: Growth phase-dependent variation in protein composition of the Escherichia coli nucleoid J Bacteriol 1999, 181:6361-6370 Azam TA, Ishihama...
- 4
- 307
- 0
báo cáo khoa học: " Isolation and functional characterization of a cDNA coding a hydroxycinnamoyltransferase involved in phenylpropanoid biosynthesis in Cynara cardunculus L" potx
... 5'-CCCGACGATCAGGATA-3' 5'-ACCGCCGGGATGAGTT-3' 5'-CCGCCTCCACGAACAA-3' 5'-TTCCGTTTCGTTTCTTCAA-3' 5'-TGGCCATAACCATTTTAGATAT-3' 5'-GGGTTTCATATGAAGATCGAGGTGAGAGAA-3' 5'-CGGGATCCTTAGATATCATATAGGAACTTGC-3' ... N-hydroxycinnamoyl/benzoyltransferase from I batatas (AB035183); AtHCT, shikimate/quinate hydroxycinnamoyltransferase of A thaliana (At5g48930); NtHCT, shikimate/ quinate hydroxycinnamoyltransferase of N tabacum (AJ507825); ... HPLC's All authors read and approved the final manuscript Acknowledgements We thank Prof G Mauromicale and Dr R Mauro of the University of Catania for providing plant material We are particularly...
- 14
- 535
- 0
Discovery of botanical flavonoids as dual peroxisome proliforator, activated receptor (PPAR) ligands and functional characterization of a natural PPAR polymorphism that enhances interaction with nuclear compressor
... Characterization of flavonoids on PPARα and PPARγ activity 103 3.3 Characterization of flavonoids and PPARα ligands on a natural PPARα V22 7A variant 124 3.4 Mechanism(s) elucidation of attenuated ... Bio-Forum July 2427, 2004 at Shanghai International Convention Center, Shanghai, China xiv ABBREVIATIONS 15dPGJ2 Å3 ABCA1 ACO Acrp30 AD AF-1 AF-2 AM aP2 apoA-I apoA-II apoA-V apoC-III AR bp Bio Cal CAP350 ... clinical data on the use of PPARγ agonists for the treatment of diabetes and the use of PPARα agonists for the treatment of dyslipidemia and coronary heart disease makes it likely that dual PPARα and...
- 263
- 267
- 0
Genomic organization and functional characterization of a novel cancer associated gene u0 44
... mammals (Bandyopadhyay et al., 1999; Bandyopadhyay et al., 2002) It contains a signal peptide at the N-terminus, a ZP domain, a C-terminal putative TMD, and a cytoplasmic tail (Lopez-Casillas ... strand breaks that inhibit DNA replication leading to the activation of several signal transduction pathways that involves ATR, p53, p73 and MAPK resulting in the activation of apoptosis (Judson ... ovarian cancer 1.3.3 Cisplatin Mode of Action and Molecular Basis of Resistance Cisplatin belongs to the chemotherapy group of alkylating agents that binds to DNA creating adduct, crosslinks, and...
- 198
- 331
- 0
Characterization of diffusion behavior of a novel extra cellular sphingolipid associated peptide probe by fluorescence correlation spectroscopy and imaging total internal reflection fluorescence correlation spectroscopy
... distances of the confocal volume xiv List of Publications Sarita Hebbar, Esther Lee, Manoj Manna, Steffen Steinert, Goparaju Sravan Kumar, Markus Wenk, Thorsten Wohland and Rachel Kraut A fluorescent ... Pan Xiaotao, who guided me in learning the confocal FCS instrumentation during the initial days of my research; Dr Balakrishnan Kannan for his valuable tips and guidance for laser alignment and ... rafts form and disperse rapidly and capriciously, and can also coalesce and disintegrate [95] Consistent with the model, this dynamic partitioning of diffusive behavior of raft associated markers...
- 177
- 361
- 0
Tài liệu Báo cáo khoa học: Structural and functional investigations of Ureaplasma parvum UMP kinase – a potential antibacterial drug target ppt
... from Ureaplasma parvum the following primers: F133N-fw (5¢-GATTTTTGTGGCT GGAACAGGAAACCCATATTTTACAACTGATTCG) and F133N-rv (5¢-CGAATCAGTTGTAAAATATGGGT TTCCTGTTCCAGCCACAAAAAT), with the altered ... bold and underlined The F13 3A mutation was created using the following primers: F133Afw (5¢-GTGGCTGGAACAGGAGCGCCATATTTTACA ACTGATTCG) and F13 3A- rv (5¢-CGAATCAGTTGTAA AATATGGCGCTCCTGTTCCAGCCAC) ... Venter JC (2006) Essential genes of a minimal bacterium Proc Natl Acad Sci USA 103, 425–430 12 Yamanaka K, Ogura T, Niki H & Hiraga S (1992) Identification and characterization of the smbA gene, a...
- 12
- 656
- 0
Tài liệu Báo cáo khoa học: Characterization and functional expression of cDNAs encoding thyrotropin-releasing hormone receptor from Xenopus laevis Identification of a novel subtype of thyrotropin-releasing hormone receptor ppt
... second set, A5 2 (5¢AGAGTGAGCAGGTAGCGAGAGGAG-3¢)/TRHR-8 (5¢-GGGGGTGTAGAGGTTTCTGGAGAC-3¢); third set, A5 3 (5¢-CGAGAGGAGCATTAGA-TAGATG Ó FEBS 2002 CAG-3¢)/TRHR-9 (5¢-GCCGAAATGTTGATGCCCA GATAC-3¢) (Fig ... CGTAACTTTTGCTG-3¢)/TRHR1-4 antisense (5¢-TC TGTTAAATGTACCTAAGTAGGCA-3¢) and TRHR2-2 sense (5¢-CAGCAAAATGGAAAATAGTAGC-3¢)/ TRHR2-4 antisense (5¢-CGACACTGTAGTAG-AGAT CACC-3¢), respectively The PCR ... ventral and dorsal skin, testis, stomach, intestine, urinary bladder and lungs of adult male Xenopus laevis toads Poly (A) + RNA extracted from rat testes and ovaries were used as positive and negative...
- 11
- 506
- 0
Báo cáo khoa học: Functional analysis of a murine monoclonal antibody against the repetitive region of the fibronectin-binding adhesins fibronectin-binding protein A and fibronectin-binding protein B from Staphylococcus aureus pot
... shared by repeats of FnBPA and FnBPB, and inhibits staphylococcal attachment to Fn Taken together, these data strongly suggest the conservation of structural and functional features of the Fn-binding ... FITC was measured in the FL1 channel (510–535 nm bandpass filter) Data were recorded and analyzed with flowmax software from Partec Statistical analysis of ELISA experiments Each experiment was repeated ... FnBRA lacking FnBPA-9 and FnBPA-10 (A, C) Recombinant, His-tagged full-length FnBRA and FnBRA lacking FnBPA-9 and FnBPA-10 (FnBRAD9,10) were immobilized on microtiter wells (1 lg in 100 lL) and...
- 16
- 560
- 0
Báo cáo khoa học: Structural and functional evidence for a singular repertoire of BMP receptor signal transducing proteins in the lophotrochozoan Crassostrea gigas suggests a shared ancestral BMP/activin pathway docx
... Thick vein D melanogaster (XP_079689), Wishful thinking D melanogaster (AAF60175), ALK-1 Ephydatia fluvatilis (BAA82601), ALK-2 E fluvatilis (BAA82602), ALK-4 E fluvatilis (AB026827), ALK-6 E fluvatilis ... BMP/activin pathway in Crassostrea gigas A Herpin et al A Crassostrea gigas C2 domain ALK-6 E fluviatilis C2 domain 77 Crassostrea gigas C1 domain 76 88 Wit D melanogaster ActR-2b H sapiens 92 Activin ... (blastula, gastrula, trochophore larvae, D larvae, and 14 days post fertilization larvae, pediveliger larvae and metamorphosing larvae) were used as samples Although Cg-BMPR1 and Cg-TGFbsfR2 transcripts...
- 17
- 508
- 0
Báo cáo khoa học: Functional fine-mapping and molecular modeling of a conserved loop epitope of the measles virus hemagglutinin protein pdf
... (ETC FQQACKGKIQALCENPEWA) (D), or only Cys386 and Cys394 (KGETBFQQACKGKIQALCENPEWA) (E) or the shortened HNE peptide (KGQQACKGKIQALCEN) (F) as well as sequential epitopes with intermolecular and ... 905–918 Goldbaum, F .A. , Schwarz, F.P., Eisenstein, E., Cauerhff, A. , Mariuzza, R .A & Poljak, R .J (1996) The effect of water activity on the association constant and the enthalpy of reaction between ... and antigenicity of the measles virus haemagglutinin protein J Gen Virol 75, 2173–2181 Langedijk, J. P., Daus, F .J & van Oirschot, J. T (1997) Sequence and structure alignment of Paramyxoviridae...
- 13
- 492
- 0
Báo cáo khoa học: Molecular cloning and functional expression of the human sodium channel b1B subunit, a novel splicing variant of the b1 subunit potx
... Cloning and characterization of Na+ channel b1B (Eur J Biochem 270) 4763 reaction (RT-PCR) and RACE-PCR Marathon-ReadyTM human adrenal gland and fetal brain cDNA libraries were purchased from ... probe was labeled and purified as described above A kb human b-actin cDNA fragment was used as the control probe and labeled with Ready-To-GoTM DNA Labelling Bead (–dCTP) (Amersham Pharmacia Biotech.), ... used for acquisition and analysis of data Leakage and linear capacity currents were subtracted by using P/4 protocols Data were sampled once every ls and were filtered at 1/5 of the sampling frequency...
- 9
- 415
- 0
Báo cáo khoa học: Cloning and functional characterization of Arabidopsis thaliana D-amino acid aminotransferase – D-aspartate behavior during germination pdf
... TCAGTAAGGAACAAGAACACG-3¢; Atbcat2, 5¢-GT CGACAGATGATCAAAACAATCACATCTCTACGC-3¢ and 5¢-CTCGAGTCAGTTGATATCTGTGACCCATCC3¢; and Atbcat4, 5¢-GAATTCATGGCTCCTTCTGCGCA ACCTC-3¢ and 5¢-CTCGAGTCAGCCCTGGCGGTCA ATCTCCAC-3¢ ... ATGGTTAAGATGACTTGGTGACTTCATG-3¢; Atasp3, 5¢-AGATCTATGAAAACTACTCATTTCTCTTCC-3¢ and 5¢-GGTACCTCAGACGGCTTTGGTGACAACAGC-3¢; and Atasp5, 5¢-GAGCTCGATGGCTTCTTTAATGTTATCT CTC-3¢ and 5¢-CCATGGTCAGCTTACGTTATGGTAT GAGTC-3¢ The SacI–NcoI ... CAP trapper Plant J 15, 707–720 Seki M, Narusaki M, Kamiya A, Ishida J, Satou M, Sakurai T, Nakajima M, Enju M, Akiyama K, Oono Y et al (2002) Functional annotation of a full length Arabidopsis...
- 13
- 401
- 0
Báo cáo hóa học: " Dynamic behavior of a nonlinear rational difference equation and generalization" ppt
... oscillation of a family of difference equations J Math Anal Appl 294, 614–620 (2004) doi:10.1016 /j. jmaa.2004.02.039 Sun, T., Xi, H.: Global attractivity for a family of nonlinear difference equations ... doi:10.1016 /j. amc.2004.03.023 Li, X: Global behavior for a fourth-order rational di_erenceequation J Math Anal Appl 312, 103–111 (2005) Berenhaut, KS, Foley, JD, Stevic, S: The global attractivity of ... the main part of this paper, QX and GY corrected the main theorems XL participated in the design and coordination All authors read and approved the final manuscript Competing interests The authors...
- 8
- 283
- 0
báo cáo hóa học:" Global existence and asymptotic behavior of smooth solutions for a bipolar Euler-Poisson system in the quarter plane" doc
... studied large-time behavior and quasineutral limit of L∞ solution of the Cauchy problem in [15] As far as we know, no results about the global existence and large time behavior to (1.2) with boundary ... Hsiao and Zhang [7, 8] established the global entropic weak solutions in the framework of compensated compactness on the whole real line and spatial bounded domain respectively Zhu and Hattori ... Global existence and asymptotic behavior of smooth solutions for a bipolar Euler–Poisson system in the quarter plane Yeping Li Department of Mathematics, Shanghai Normal University, Shanghai 200234,...
- 22
- 366
- 0
Báo cáo hóa học: " Research Article Analysis of Transient and Steady-State Behavior of a Multichannel Filtered-x Partial-Error Affine Projection Algorithm" docx
... k) R(i +K k) %K (n +K k) × UT k) %K (n + K − k) (i +K K ×E k= 1 −1 U(i +K k) %K (n +K k) R(i +K k) %K (n +K k) × d(i +K k) %K (n + K − k) , (22) which in the hypothesis of stationary input signals is equal ... w(mK + i + K) = E Mi (mK + i) E w(mK + i) − E mi (mK + i) (A. 3) We manipulate (A. 1), (A. 2), and (A. 3) by taking advantage of the properties of the vector operator vec{·} and of the Kronecker ... (33) and in (34) provide accurate estimates of the steady-state MSE and of the steady-state A Carini and G L Sicuranza Table 3: First eight coefficients of the MMS solution (wo ) and of the asymptotic...
- 15
- 311
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 động cơ điện không đồng bộ một pha thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008